![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
![]() | Protein Indole-3-pyruvate decarboxylase [89637] (1 species) |
![]() | Species Enterobacter cloacae [TaxId:550] [89638] (1 PDB entry) |
![]() | Domain d1ovmd1: 1ovm D:181-341 [87470] Other proteins in same PDB: d1ovma2, d1ovma3, d1ovmb2, d1ovmb3, d1ovmc2, d1ovmc3, d1ovmd2, d1ovmd3 complexed with mg, tpp |
PDB Entry: 1ovm (more details), 2.65 Å
SCOPe Domain Sequences for d1ovmd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ovmd1 c.31.1.3 (D:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} nalthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmah atmlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqlt paqtievqphaarvgdvwftgipmnqaietlvelckqhvha
Timeline for d1ovmd1: