![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (7 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
![]() | Protein Indole-3-pyruvate decarboxylase [89654] (1 species) |
![]() | Species Enterobacter cloacae [TaxId:550] [89655] (1 PDB entry) |
![]() | Domain d1ovmc3: 1ovm C:356-551 [87469] Other proteins in same PDB: d1ovma1, d1ovma2, d1ovmb1, d1ovmb2, d1ovmc1, d1ovmc2, d1ovmd1, d1ovmd2 |
PDB Entry: 1ovm (more details), 2.65 Å
SCOP Domain Sequences for d1ovmc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ovmc3 c.36.1.9 (C:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae} pdgsltqenfwrtlqtfirpgdiiladqgtsafgaidlrlpadvnfivqplwgsigytla aafgaqtacpnrrvivltgdgaaqltiqelgsmlrdkqhpiilvlnnegytveraihgae qryndialwnwthipqalsldpqsecwrvseaeqladvlekvahherlslievmlpkadi ppllgaltkaleacnn
Timeline for d1ovmc3: