![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (5 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
![]() | Protein Indole-3-pyruvate decarboxylase [89648] (1 species) |
![]() | Species Enterobacter cloacae [TaxId:550] [89649] (1 PDB entry) |
![]() | Domain d1ovmb2: 1ovm B:3-180 [87465] Other proteins in same PDB: d1ovma1, d1ovma3, d1ovmb1, d1ovmb3, d1ovmc1, d1ovmc3, d1ovmd1, d1ovmd3 |
PDB Entry: 1ovm (more details), 2.65 Å
SCOP Domain Sequences for d1ovmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ovmb2 c.36.1.5 (B:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae} tpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaadgy arckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgdge frhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppv
Timeline for d1ovmb2: