SCOPe 2.01: Domain d1ovlf_: 1ovl F:

Lineage for d1ovlf_ (1ovl F:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Orphan nuclear receptor NURR1 [89142] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89143] (1 PDB entry)

8. Domain d1ovlf_: 1ovl F: [87460]
   complexed with br, iod, k

Details for d1ovlf_

PDB Entry: 1ovl, 2.2 Å

PDB Description: Crystal Structure of Nurr1 LBD

PDB Compounds: (F:) Orphan nuclear receptor NURR1 (MSE 496, 511)

SCOPe Domain Sequences for d1ovlf_:

Sequence, based on SEQRES records:

>d1ovlf_ a.123.1.1 (F:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
slisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfydlltgsmeiirgwae
kipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgew
idsivefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfn
ngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

Sequence, based on observed residues (ATOM records):

>d1ovlf_ a.123.1.1 (F:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
slisalvrahvdsnpamtsldysrfqandtqhiqqfydlltgsmeiirgwaekipgfadl
pkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefs
snlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnnpnylskl
lgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

Timeline for d1ovlf_:

• d1ovlf_ first appeared in SCOP 1.65
  
• d1ovlf_ appears in SCOP 1.75
  
• d1ovlf_ appears in SCOPe 2.02
  
• d1ovlf_ appears in the current release, SCOPe 2.08