Lineage for d1ovle_ (1ovl E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008887Protein Orphan nuclear receptor NURR1 [89142] (1 species)
  7. 2008888Species Human (Homo sapiens) [TaxId:9606] [89143] (1 PDB entry)
  8. 2008893Domain d1ovle_: 1ovl E: [87459]
    complexed with br, iod, k

Details for d1ovle_

PDB Entry: 1ovl (more details), 2.2 Å

PDB Description: Crystal Structure of Nurr1 LBD
PDB Compounds: (E:) Orphan nuclear receptor NURR1 (MSE 496, 511)

SCOPe Domain Sequences for d1ovle_:

Sequence, based on SEQRES records: (download)

>d1ovle_ a.123.1.1 (E:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
rtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrfqanpdy
qmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelfvlrlay
rsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafsciaalamvt
erhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlctqglqri
fylkledlvpppaiidklfldtlpf

Sequence, based on observed residues (ATOM records): (download)

>d1ovle_ a.123.1.1 (E:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
rtdslkgrrgrlpsslisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfyd
lltgsmeiirgwaekipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngv
vlhrlqcvrgfgewidsivefssnlqnmnidisafsciaalamvterhglkepkrveelq
nkivnclkdhvtfnngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaii
dklfldtlpf

SCOPe Domain Coordinates for d1ovle_:

Click to download the PDB-style file with coordinates for d1ovle_.
(The format of our PDB-style files is described here.)

Timeline for d1ovle_: