Lineage for d1ovld_ (1ovl D:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448073Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 448074Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 448075Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (30 proteins)
  6. 448187Protein Orphan nuclear receptor NURR1 [89142] (1 species)
  7. 448188Species Human (Homo sapiens) [TaxId:9606] [89143] (1 PDB entry)
  8. 448192Domain d1ovld_: 1ovl D: [87458]

Details for d1ovld_

PDB Entry: 1ovl (more details), 2.2 Å

PDB Description: Crystal Structure of Nurr1 LBD

SCOP Domain Sequences for d1ovld_:

Sequence, based on SEQRES records: (download)

>d1ovld_ a.123.1.1 (D:) Orphan nuclear receptor NURR1 {Human (Homo sapiens)}
slisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfydlltgsmeiirgwae
kipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgew
idsivefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfn
ngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

Sequence, based on observed residues (ATOM records): (download)

>d1ovld_ a.123.1.1 (D:) Orphan nuclear receptor NURR1 {Human (Homo sapiens)}
slisalvrahvdsnpamtsldysrfqanpddtqhiqqfydlltgsmeiirgwaekipgfa
dlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsive
fssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnngglnr
pnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

SCOP Domain Coordinates for d1ovld_:

Click to download the PDB-style file with coordinates for d1ovld_.
(The format of our PDB-style files is described here.)

Timeline for d1ovld_: