Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein Orphan nuclear receptor NURR1 [89142] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89143] (3 PDB entries) |
Domain d1ovlb_: 1ovl B: [87456] complexed with br, iod, k |
PDB Entry: 1ovl (more details), 2.2 Å
SCOPe Domain Sequences for d1ovlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ovlb_ a.123.1.1 (B:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} slisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfydlltgsmeiirgwae kipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgew idsivefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfn ngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf
Timeline for d1ovlb_: