Lineage for d1ovlb_ (1ovl B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012364Protein Orphan nuclear receptor NURR1 [89142] (1 species)
  7. 2012365Species Human (Homo sapiens) [TaxId:9606] [89143] (1 PDB entry)
  8. 2012367Domain d1ovlb_: 1ovl B: [87456]
    complexed with br, iod, k

Details for d1ovlb_

PDB Entry: 1ovl (more details), 2.2 Å

PDB Description: Crystal Structure of Nurr1 LBD
PDB Compounds: (B:) Orphan nuclear receptor NURR1 (MSE 496, 511)

SCOPe Domain Sequences for d1ovlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovlb_ a.123.1.1 (B:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
slisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfydlltgsmeiirgwae
kipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgew
idsivefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfn
ngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

SCOPe Domain Coordinates for d1ovlb_:

Click to download the PDB-style file with coordinates for d1ovlb_.
(The format of our PDB-style files is described here.)

Timeline for d1ovlb_: