Lineage for d1ovlb_ (1ovl B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360318Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 360319Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 360320Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (27 proteins)
  6. 360410Protein Orphan nuclear receptor NURR1 [89142] (1 species)
  7. 360411Species Human (Homo sapiens) [TaxId:9606] [89143] (1 PDB entry)
  8. 360413Domain d1ovlb_: 1ovl B: [87456]

Details for d1ovlb_

PDB Entry: 1ovl (more details), 2.2 Å

PDB Description: Crystal Structure of Nurr1 LBD

SCOP Domain Sequences for d1ovlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovlb_ a.123.1.1 (B:) Orphan nuclear receptor NURR1 {Human (Homo sapiens)}
slisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfydlltgsmeiirgwae
kipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgew
idsivefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfn
ngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

SCOP Domain Coordinates for d1ovlb_:

Click to download the PDB-style file with coordinates for d1ovlb_.
(The format of our PDB-style files is described here.)

Timeline for d1ovlb_: