Class a: All alpha proteins [46456] (289 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) dimer of identical subunits |
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins) automatically mapped to Pfam PF00216 |
Protein Integration host factor alpha subunit (IHFA) [88878] (1 species) heterodimer of two related subunits |
Species Escherichia coli [TaxId:562] [88879] (4 PDB entries) |
Domain d1ouza_: 1ouz A: [87449] Other proteins in same PDB: d1ouzb_ protein/DNA complex; mutant |
PDB Entry: 1ouz (more details), 2.41 Å
SCOPe Domain Sequences for d1ouza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ouza_ a.55.1.1 (A:) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]} altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp grnpktgedipitarrvvtfrpgqklksrvenaspk
Timeline for d1ouza_: