SCOPe 2.08: Domain d1ouza_: 1ouz A:

Lineage for d1ouza_ (1ouz A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein Integration host factor alpha subunit (IHFA) [88878] (1 species)
   heterodimer of two related subunits

7. Species Escherichia coli [TaxId:562] [88879] (4 PDB entries)

8. Domain d1ouza_: 1ouz A: [87449]
   Other proteins in same PDB: d1ouzb_
   protein/DNA complex; mutant

Details for d1ouza_

PDB Entry: 1ouz, 2.41 Å

PDB Description: crystal structure of a mutant ihf (betae44a) complexed with a variant h' site (t44a)

PDB Compounds: (A:) Integration host factor alpha-subunit

SCOPe Domain Sequences for d1ouza_:

Sequence; same for both SEQRES and ATOM records:

>d1ouza_ a.55.1.1 (A:) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]}
altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
grnpktgedipitarrvvtfrpgqklksrvenaspk

Timeline for d1ouza_:

• d1ouza_ first appeared in SCOP 1.65
  
• d1ouza_ appears in SCOPe 2.07