SCOPe 2.08: Domain d1ou5a1: 1ou5 A:151-354

Lineage for d1ou5a1 (1ou5 A:151-354)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily)
   multihelical; can be divided into three subdomains (neck, body and tail)

4. Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family)
   the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like

5. Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins)
   the 'neck' domain corresponds to the C-terminal part of Pfam PF01743

6. Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species)

7. Species Human (Homo sapiens), mitochondrial [TaxId:9606] [89128] (1 PDB entry)

8. Domain d1ou5a1: 1ou5 A:151-354 [87445]
   Other proteins in same PDB: d1ou5a2, d1ou5a3, d1ou5b2, d1ou5b3
   the tail subdomain is not present in this structure
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1ou5a1

PDB Entry: 1ou5, 3.4 Å

PDB Description: crystal structure of human cca-adding enzyme

PDB Compounds: (A:) tRNA CCA-adding enzyme

SCOPe Domain Sequences for d1ou5a1:

Sequence; same for both SEQRES and ATOM records:

>d1ou5a1 a.173.1.1 (A:151-354) tRNA CCA-adding enzyme, C-terminal domains {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
kvrfvghakqriqedylrilryfrfygrivdkpgdhdpetleaiaenakglagisgeriw
velkkilvgnhvnhlihliydldvapyiglpanasleefdkvsknvdgfspkpvtllasl
fkvqddvtkldlrlkiakeeknlglfivknrkdlikatdssdplkpyqdfiidsrepdat
trvcellkyqgehcllkemqqwsi

Timeline for d1ou5a1:

• d1ou5a1 first appeared in SCOP 1.65
  
• d1ou5a1 appears in SCOPe 2.07