Lineage for d1otuf2 (1otu F:107-211)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289981Domain d1otuf2: 1otu F:107-211 [87444]
    Other proteins in same PDB: d1otua_, d1otub_, d1otuc1, d1otuc2, d1otud1, d1otue1, d1otue2, d1otuf1
    part of anti-CLC chloride channel Fab
    complexed with cl; mutant

Details for d1otuf2

PDB Entry: 1otu (more details), 3.3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148q mutant and fab complex

SCOP Domain Sequences for d1otuf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otuf2 b.1.1.2 (F:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOP Domain Coordinates for d1otuf2:

Click to download the PDB-style file with coordinates for d1otuf2.
(The format of our PDB-style files is described here.)

Timeline for d1otuf2: