SCOP 1.65: Domain d1otuf2: 1otu F:107-211

Lineage for d1otuf2 (1otu F:107-211)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d1otuf2: 1otu F:107-211 [87444]
   Other proteins in same PDB: d1otua_, d1otub_, d1otuc1, d1otuc2, d1otud1, d1otue1, d1otue2, d1otuf1
   part of anti-CLC chloride channel Fab
   complexed with cl; mutant

Details for d1otuf2

PDB Entry: 1otu, 3.3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148q mutant and fab complex

SCOP Domain Sequences for d1otuf2:

Sequence; same for both SEQRES and ATOM records:

>d1otuf2 b.1.1.2 (F:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

Timeline for d1otuf2:

• d1otuf2 is new in SCOP 1.65
  
• d1otuf2 appears in SCOP 1.67
  
• d1otuf2 appears in the current release, SCOPe 2.08