Lineage for d1otue1 (1otu E:2-121)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1287992Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 1288066Domain d1otue1: 1otu E:2-121 [87441]
    Other proteins in same PDB: d1otua_, d1otub_, d1otuc2, d1otud1, d1otud2, d1otue2, d1otuf1, d1otuf2
    part of anti-CLC chloride channel Fab
    complexed with cl; mutant

Details for d1otue1

PDB Entry: 1otu (more details), 3.3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148q mutant and fab complex
PDB Compounds: (E:) Fab Fragment (Heavy Chain)

SCOPe Domain Sequences for d1otue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otue1 b.1.1.1 (E:2-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss

SCOPe Domain Coordinates for d1otue1:

Click to download the PDB-style file with coordinates for d1otue1.
(The format of our PDB-style files is described here.)

Timeline for d1otue1: