Lineage for d1otud1 (1otu D:1-106)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 452004Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (19 PDB entries)
  8. 452025Domain d1otud1: 1otu D:1-106 [87439]
    Other proteins in same PDB: d1otua_, d1otub_, d1otuc1, d1otuc2, d1otud2, d1otue1, d1otue2, d1otuf2

Details for d1otud1

PDB Entry: 1otu (more details), 3.3 Å

PDB Description: Structure of the Escherichia coli ClC Chloride channel E148Q mutant and Fab Complex

SCOP Domain Sequences for d1otud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otud1 b.1.1.1 (D:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

SCOP Domain Coordinates for d1otud1:

Click to download the PDB-style file with coordinates for d1otud1.
(The format of our PDB-style files is described here.)

Timeline for d1otud1: