SCOP 1.69: Domain d1otuc2: 1otu C:122-222

Lineage for d1otuc2 (1otu C:122-222)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1otuc2: 1otu C:122-222 [87438]
   Other proteins in same PDB: d1otua_, d1otub_, d1otuc1, d1otud1, d1otud2, d1otue1, d1otuf1, d1otuf2

Details for d1otuc2

PDB Entry: 1otu, 3.3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148q mutant and fab complex

SCOP Domain Sequences for d1otuc2:

Sequence; same for both SEQRES and ATOM records:

>d1otuc2 b.1.1.2 (C:122-222) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra

Timeline for d1otuc2:

• d1otuc2 first appeared in SCOP 1.65
  
• d1otuc2 appears in SCOP 1.67
  
• d1otuc2 appears in SCOP 1.71
  
• d1otuc2 appears in the current release, SCOPe 2.08