Lineage for d1otub_ (1otu B:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340637Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 340638Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 340639Family f.20.1.1: Clc chloride channel [69912] (1 protein)
    duplication: consist of two similar structural parts
  6. 340640Protein Clc chloride channel [69913] (2 species)
  7. 340641Species Escherichia coli [TaxId:562] [69914] (4 PDB entries)
  8. 340653Domain d1otub_: 1otu B: [87436]
    Other proteins in same PDB: d1otuc1, d1otuc2, d1otud1, d1otud2, d1otue1, d1otue2, d1otuf1, d1otuf2
    complexed with cl; mutant

Details for d1otub_

PDB Entry: 1otu (more details), 3.3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148q mutant and fab complex

SCOP Domain Sequences for d1otub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otub_ f.20.1.1 (B:) Clc chloride channel {Escherichia coli}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOP Domain Coordinates for d1otub_:

Click to download the PDB-style file with coordinates for d1otub_.
(The format of our PDB-style files is described here.)

Timeline for d1otub_: