Lineage for d1ottf2 (1ott F:107-211)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 366095Domain d1ottf2: 1ott F:107-211 [87434]
    Other proteins in same PDB: d1otta_, d1ottb_, d1ottc1, d1ottc2, d1ottd1, d1otte1, d1otte2, d1ottf1
    part of anti-CLC chloride channel Fab
    complexed with cl; mutant

Details for d1ottf2

PDB Entry: 1ott (more details), 3 Å

PDB Description: Structure of the Escherichia coli ClC Chloride channel E148A mutant and Fab Complex
PDB Compounds: (F:)

SCOP Domain Sequences for d1ottf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ottf2 b.1.1.2 (F:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOP Domain Coordinates for d1ottf2:

Click to download the PDB-style file with coordinates for d1ottf2.
(The format of our PDB-style files is described here.)

Timeline for d1ottf2: