Lineage for d1otte2 (1ott E:122-222)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289477Domain d1otte2: 1ott E:122-222 [87432]
    Other proteins in same PDB: d1otta_, d1ottb_, d1ottc1, d1ottd1, d1ottd2, d1otte1, d1ottf1, d1ottf2
    part of anti-CLC chloride channel Fab
    complexed with cl; mutant

Details for d1otte2

PDB Entry: 1ott (more details), 3 Å

PDB Description: Structure of the Escherichia coli ClC Chloride channel E148A mutant and Fab Complex
PDB Compounds: (E:)

SCOP Domain Sequences for d1otte2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otte2 b.1.1.2 (E:122-222) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra

SCOP Domain Coordinates for d1otte2:

Click to download the PDB-style file with coordinates for d1otte2.
(The format of our PDB-style files is described here.)

Timeline for d1otte2: