Lineage for d1ottc1 (1ott C:2-121)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546768Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (49 PDB entries)
  8. 546821Domain d1ottc1: 1ott C:2-121 [87427]
    Other proteins in same PDB: d1otta_, d1ottb_, d1ottc2, d1ottd1, d1ottd2, d1otte2, d1ottf1, d1ottf2

Details for d1ottc1

PDB Entry: 1ott (more details), 3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148a mutant and fab complex

SCOP Domain Sequences for d1ottc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ottc1 b.1.1.1 (C:2-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss

SCOP Domain Coordinates for d1ottc1:

Click to download the PDB-style file with coordinates for d1ottc1.
(The format of our PDB-style files is described here.)

Timeline for d1ottc1: