Lineage for d1otta_ (1ott A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957090Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 1957091Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 1957092Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 1957093Protein Clc chloride channel [69913] (2 species)
  7. 1957094Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 1957115Domain d1otta_: 1ott A: [87425]
    Other proteins in same PDB: d1ottc1, d1ottc2, d1ottd1, d1ottd2, d1otte1, d1otte2, d1ottf1, d1ottf2
    complexed with cl; mutant

Details for d1otta_

PDB Entry: 1ott (more details), 3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148a mutant and fab complex
PDB Compounds: (A:) Voltage-gated ClC-type chloride channel eriC

SCOPe Domain Sequences for d1otta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otta_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

SCOPe Domain Coordinates for d1otta_:

Click to download the PDB-style file with coordinates for d1otta_.
(The format of our PDB-style files is described here.)

Timeline for d1otta_: