Lineage for d1otsf2 (1ots F:107-211)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289912Domain d1otsf2: 1ots F:107-211 [87424]
    Other proteins in same PDB: d1otsa_, d1otsb_, d1otsc1, d1otsc2, d1otsd1, d1otse1, d1otse2, d1otsf1
    part of anti-CLC chloride channel Fab
    complexed with cl

Details for d1otsf2

PDB Entry: 1ots (more details), 2.51 Å

PDB Description: Structure of the Escherichia coli ClC Chloride channel and Fab Complex

SCOP Domain Sequences for d1otsf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otsf2 b.1.1.2 (F:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOP Domain Coordinates for d1otsf2:

Click to download the PDB-style file with coordinates for d1otsf2.
(The format of our PDB-style files is described here.)

Timeline for d1otsf2: