SCOP 1.65: Domain d1otsf2: 1ots F:107-211

Lineage for d1otsf2 (1ots F:107-211)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d1otsf2: 1ots F:107-211 [87424]
   Other proteins in same PDB: d1otsa_, d1otsb_, d1otsc1, d1otsc2, d1otsd1, d1otse1, d1otse2, d1otsf1
   part of anti-CLC chloride channel Fab
   complexed with cl

Details for d1otsf2

PDB Entry: 1ots, 2.51 Å

PDB Description: Structure of the Escherichia coli ClC Chloride channel and Fab Complex

PDB Compounds: (F:)

SCOP Domain Sequences for d1otsf2:

Sequence; same for both SEQRES and ATOM records:

>d1otsf2 b.1.1.2 (F:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

Timeline for d1otsf2:

• d1otsf2 appears in SCOP 1.67
  
• d1otsf2 appears in the current release, SCOPe 2.07