Lineage for d1otsb_ (1ots B:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340637Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 340638Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 340639Family f.20.1.1: Clc chloride channel [69912] (1 protein)
    duplication: consist of two similar structural parts
  6. 340640Protein Clc chloride channel [69913] (2 species)
  7. 340641Species Escherichia coli [TaxId:562] [69914] (4 PDB entries)
  8. 340643Domain d1otsb_: 1ots B: [87416]
    Other proteins in same PDB: d1otsc1, d1otsc2, d1otsd1, d1otsd2, d1otse1, d1otse2, d1otsf1, d1otsf2
    complexed with cl

Details for d1otsb_

PDB Entry: 1ots (more details), 2.51 Å

PDB Description: Structure of the Escherichia coli ClC Chloride channel and Fab Complex

SCOP Domain Sequences for d1otsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otsb_ f.20.1.1 (B:) Clc chloride channel {Escherichia coli}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOP Domain Coordinates for d1otsb_:

Click to download the PDB-style file with coordinates for d1otsb_.
(The format of our PDB-style files is described here.)

Timeline for d1otsb_: