Lineage for d1otsa_ (1ots A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253242Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2253243Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2253244Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2253245Protein Clc chloride channel [69913] (2 species)
  7. 2253246Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 2253247Domain d1otsa_: 1ots A: [87415]
    Other proteins in same PDB: d1otsc1, d1otsc2, d1otsd1, d1otsd2, d1otse1, d1otse2, d1otsf1, d1otsf2
    complexed with cl

Details for d1otsa_

PDB Entry: 1ots (more details), 2.51 Å

PDB Description: Structure of the Escherichia coli ClC Chloride channel and Fab Complex
PDB Compounds: (A:) Voltage-gated ClC-type chloride channel eriC

SCOPe Domain Sequences for d1otsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

SCOPe Domain Coordinates for d1otsa_:

Click to download the PDB-style file with coordinates for d1otsa_.
(The format of our PDB-style files is described here.)

Timeline for d1otsa_: