Lineage for d1otrb_ (1otr B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717214Protein Ubiquitin [54238] (3 species)
  7. 717215Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (4 PDB entries)
  8. 717216Domain d1otrb_: 1otr B: [87414]
    Other proteins in same PDB: d1otra_

Details for d1otrb_

PDB Entry: 1otr (more details)

PDB Description: solution structure of a cue-ubiquitin complex
PDB Compounds: (B:) Ubiquitin

SCOP Domain Sequences for d1otrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otrb_ d.15.1.1 (B:) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOP Domain Coordinates for d1otrb_:

Click to download the PDB-style file with coordinates for d1otrb_.
(The format of our PDB-style files is described here.)

Timeline for d1otrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1otra_