SCOP 1.69: Domain d1otrb_: 1otr B:

Lineage for d1otrb_ (1otr B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (6 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (17 proteins)

6. Protein Ubiquitin [54238] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (2 PDB entries)

8. Domain d1otrb_: 1otr B: [87414]
   Other proteins in same PDB: d1otra_

Details for d1otrb_

PDB Entry: 1otr

PDB Description: solution structure of a cue-ubiquitin complex

SCOP Domain Sequences for d1otrb_:

Sequence; same for both SEQRES and ATOM records:

>d1otrb_ d.15.1.1 (B:) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

Timeline for d1otrb_:

• d1otrb_ first appeared in SCOP 1.65
  
• d1otrb_ appears in SCOP 1.67
  
• d1otrb_ appears in SCOP 1.71
  
• d1otrb_ appears in the current release, SCOPe 2.08