![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (6 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (8 proteins) |
![]() | Protein Ubiquitin [54238] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (1 PDB entry) |
![]() | Domain d1otrb_: 1otr B: [87414] Other proteins in same PDB: d1otra_ |
PDB Entry: 1otr (more details)
SCOP Domain Sequences for d1otrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otrb_ d.15.1.1 (B:) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3} mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d1otrb_: