Lineage for d1otra_ (1otr A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278490Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
    3 helices; bundle, right-handed twist
  4. 278514Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 278536Family a.5.2.4: CUE domain [88995] (2 proteins)
  6. 278537Protein Protein Cue2 (hypothetical protein YKL090W) [88998] (1 species)
  7. 278538Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88999] (1 PDB entry)
  8. 278539Domain d1otra_: 1otr A: [87413]
    Other proteins in same PDB: d1otrb_

Details for d1otra_

PDB Entry: 1otr (more details)

PDB Description: solution structure of a cue-ubiquitin complex

SCOP Domain Sequences for d1otra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otra_ a.5.2.4 (A:) Protein Cue2 (hypothetical protein YKL090W) {Baker's yeast (Saccharomyces cerevisiae)}
nddhesklsilmdmfpaisksklqvhllennndldltiglllkenddks

SCOP Domain Coordinates for d1otra_:

Click to download the PDB-style file with coordinates for d1otra_.
(The format of our PDB-style files is described here.)

Timeline for d1otra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1otrb_