Lineage for d1ot5a2 (1ot5 A:123-460)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 314784Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 314785Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 314786Family c.41.1.1: Subtilases [52744] (10 proteins)
  6. 314797Protein Kexin, N-terminal domain [89692] (1 species)
  7. 314798Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89693] (1 PDB entry)
  8. 314799Domain d1ot5a2: 1ot5 A:123-460 [87410]
    Other proteins in same PDB: d1ot5a1, d1ot5b1

Details for d1ot5a2

PDB Entry: 1ot5 (more details), 2.4 Å

PDB Description: the 2.4 angstrom crystal structure of kex2 in complex with a peptidyl- boronic acid inhibitor

SCOP Domain Sequences for d1ot5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ot5a2 c.41.1.1 (A:123-460) Kexin, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
pvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaaivddgldyen
edlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvgvgynakisg
irilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkalvkgvtegrd
skgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcsavmavtyss
gsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqylsilsavgle
knadgdwrdsamgkkyshrygfgkidahkliemsktwe

SCOP Domain Coordinates for d1ot5a2:

Click to download the PDB-style file with coordinates for d1ot5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ot5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ot5a1