SCOPe 2.02: Domain d1ot5a1: 1ot5 A:461-599

Lineage for d1ot5a1 (1ot5 A:461-599)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.20: Proprotein convertase P-domain [89249] (3 proteins)
   a truncated form of this fold lacking one of the N-terminal strands

6. Protein Kexin, C-terminal domain [89250] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89251] (3 PDB entries)

8. Domain d1ot5a1: 1ot5 A:461-599 [87409]
   Other proteins in same PDB: d1ot5a2, d1ot5b2
   complexed with ca, nag

Details for d1ot5a1

PDB Entry: 1ot5, 2.4 Å

PDB Description: the 2.4 angstrom crystal structure of kex2 in complex with a peptidyl- boronic acid inhibitor

PDB Compounds: (A:) Kexin

SCOPe Domain Sequences for d1ot5a1:

Sequence; same for both SEQRES and ATOM records:

>d1ot5a1 b.18.1.20 (A:461-599) Kexin, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nvnaqtwfylptlyvsqstnsteetlesvitisekslqdanfkriehvtvtvdidteirg
tttvdlispagiisnlgvvrprdvssegfkdwtfmsvahwgengvgdwkikvkttenghr
idfhswrlklfgesidssk

Timeline for d1ot5a1:

• d1ot5a1 first appeared in SCOP 1.65
  
• d1ot5a1 appears in SCOPe 2.01
  
• d1ot5a1 appears in SCOPe 2.03
  
• d1ot5a1 appears in the current release, SCOPe 2.08