Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.20: Proprotein convertase P-domain [89249] (3 proteins) a truncated form of this fold lacking one of the N-terminal strands |
Protein Kexin, C-terminal domain [89250] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89251] (3 PDB entries) |
Domain d1ot5a1: 1ot5 A:461-599 [87409] Other proteins in same PDB: d1ot5a2, d1ot5b2 complexed with ca, nag |
PDB Entry: 1ot5 (more details), 2.4 Å
SCOPe Domain Sequences for d1ot5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ot5a1 b.18.1.20 (A:461-599) Kexin, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nvnaqtwfylptlyvsqstnsteetlesvitisekslqdanfkriehvtvtvdidteirg tttvdlispagiisnlgvvrprdvssegfkdwtfmsvahwgengvgdwkikvkttenghr idfhswrlklfgesidssk
Timeline for d1ot5a1: