Lineage for d1ot3h_ (1ot3 H:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313182Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 313268Protein Deoxyribonucleoside kinase [69478] (1 species)
  7. 313269Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (2 PDB entries)
  8. 313277Domain d1ot3h_: 1ot3 H: [87407]
    complexed with so4, thm

Details for d1ot3h_

PDB Entry: 1ot3 (more details), 2.5 Å

PDB Description: Crystal structure of Drosophila deoxyribonucleotide kinase complexed with the substrate deoxythymidine

SCOP Domain Sequences for d1ot3h_:

Sequence, based on SEQRES records: (download)

>d1ot3h_ c.37.1.1 (H:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster)}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad

Sequence, based on observed residues (ATOM records): (download)

>d1ot3h_ c.37.1.1 (H:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster)}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqckvlvldad

SCOP Domain Coordinates for d1ot3h_:

Click to download the PDB-style file with coordinates for d1ot3h_.
(The format of our PDB-style files is described here.)

Timeline for d1ot3h_: