Lineage for d1ot3f_ (1ot3 F:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829462Protein Deoxyribonucleoside kinase [69478] (1 species)
  7. 829463Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)
  8. 829483Domain d1ot3f_: 1ot3 F: [87405]

Details for d1ot3f_

PDB Entry: 1ot3 (more details), 2.5 Å

PDB Description: Crystal structure of Drosophila deoxyribonucleotide kinase complexed with the substrate deoxythymidine
PDB Compounds: (F:) Deoxyribonucleoside kinase

SCOP Domain Sequences for d1ot3f_:

Sequence, based on SEQRES records: (download)

>d1ot3f_ c.37.1.1 (F:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad

Sequence, based on observed residues (ATOM records): (download)

>d1ot3f_ c.37.1.1 (F:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqckvlvldad

SCOP Domain Coordinates for d1ot3f_:

Click to download the PDB-style file with coordinates for d1ot3f_.
(The format of our PDB-style files is described here.)

Timeline for d1ot3f_: