Lineage for d1ot1a4 (1ot1 A:1-406)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 305662Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 305814Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 305824Species Bacillus circulans, different strains [TaxId:1397] [51453] (31 PDB entries)
  8. 305825Domain d1ot1a4: 1ot1 A:1-406 [87395]
    Other proteins in same PDB: d1ot1a1, d1ot1a2, d1ot1a3
    complexed with acy, ca, epe, glc, mal, mpd; mutant

Details for d1ot1a4

PDB Entry: 1ot1 (more details), 2 Å

PDB Description: Bacillus circulans strain 251 Cyclodextrin glycosyl transferase mutant D135A

SCOP Domain Sequences for d1ot1a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ot1a4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviiafapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrksnpaiay

SCOP Domain Coordinates for d1ot1a4:

Click to download the PDB-style file with coordinates for d1ot1a4.
(The format of our PDB-style files is described here.)

Timeline for d1ot1a4: