Lineage for d1osna_ (1osn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109585Protein Thymidine kinase [52552] (4 species)
    contains insert all-alpha subdomain, res. 251-322
  7. 2109665Species Varicella-Zoster virus [TaxId:10335] [89659] (1 PDB entry)
  8. 2109666Domain d1osna_: 1osn A: [87387]
    complexed with adp, bvp

Details for d1osna_

PDB Entry: 1osn (more details), 3.2 Å

PDB Description: Crystal structure of Varicella zoster virus thymidine kinase in complex with BVDU-MP and ADP
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d1osna_:

Sequence, based on SEQRES records: (download)

>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-Zoster virus [TaxId: 10335]}
vkmgvlriyldgaygigkttaaeeflhhfaitpnrilligeplsywrnlagedaicgiyg
tqtrrlngdvspedaqrltahfqslfcsphaimhakisalmdtstsdlvqvnkepykiml
sdrhpiasticfplsrylvgdmspaalpgllftlpaeppgtnlvvctvslpshlsrvskr
arpgetvnlpfvmvlrnvyimlintiiflktnnwhagwntlsfcndvfkqklqksecikl
revpgiedtlfavlklpelcgefgnilplwawgmetlsnclrsmspfvlsleqtpqhaaq
elktllpqmtpanmssgawnilkelvnavqd

Sequence, based on observed residues (ATOM records): (download)

>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-Zoster virus [TaxId: 10335]}
vkmgvlriyldgaygigkttaaeeflhhfaitpnrilligeplsywrnlagedaicgiyg
tqtrrlngdvspedaqrltahfqslfcsphaimhakisalmdtstsdlvqvnkepykiml
sdrhpiasticfplsrylvgdmspaalpgllftlpaeppgtnlvvctvslpshlsrvset
vnlpfvmvlrnvyimlintiiflktnnwhagwntlsfcndvfkqklqkseciklrevpgi
edtlfavlklpelcgefgnilplwawgmetlsnclrsmspfvlsleqtpqhaaqelktll
pqmtpanmssgawnilkelvnavqd

SCOPe Domain Coordinates for d1osna_:

Click to download the PDB-style file with coordinates for d1osna_.
(The format of our PDB-style files is described here.)

Timeline for d1osna_: