Class b: All beta proteins [48724] (141 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (1 family) |
Family b.22.1.1: TNF-like [49843] (11 proteins) |
Protein Soluble part of TALL-1, sTALL-1 (BAFF) [69228] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69229] (6 PDB entries) also includes the PDB entry (1otz) that together with the entry (1p0t) provides the multimeric structure of the complex of this protein with its receptor, BAFF-R. In these entries protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP |
Domain d1osgf_: 1osg F: [87386] complexed with a br3 derived peptide; chains G, H, I, J, K and L complexed with mg |
PDB Entry: 1osg (more details), 3 Å
SCOP Domain Sequences for d1osgf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1osgf_ b.22.1.1 (F:) Soluble part of TALL-1, sTALL-1 (BAFF) {Human (Homo sapiens)} vtqdclqliadsetptiqkgsytfvpwllsfkrgsaleekenkilvketgyffiygqvly tdktyamghliqrkkvhvfgdelslvtlfrciqnmpetlpnnscysagiakleegdelql aiprenaqisldgdvtffgalkll
Timeline for d1osgf_: