![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (1 family) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (14 proteins) |
![]() | Protein Soluble part of TALL-1, sTALL-1 (BAFF) [69228] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69229] (6 PDB entries) also includes the PDB entry (1otz) that together with the entry (1p0t) provides the multimeric structure of the complex of this protein with its receptor, BAFF-R. In these entries protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP also includes the PDB entry (1otz) that together with the entry (1p0t) provides the multimeric structure of the complex of this protein with its receptor, BAFF-R. In these entries protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP |
![]() | Domain d1osgd_: 1osg D: [87384] complexed with a br3 derived peptide; chains G, H, I, J, K and L |
PDB Entry: 1osg (more details), 3 Å
SCOP Domain Sequences for d1osgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1osgd_ b.22.1.1 (D:) Soluble part of TALL-1, sTALL-1 (BAFF) {Human (Homo sapiens) [TaxId: 9606]} vtqdclqliadsetptiqkgsytfvpwllsfkrgsaleekenkilvketgyffiygqvly tdktyamghliqrkkvhvfgdelslvtlfrciqnmpetlpnnscysagiakleegdelql aiprenaqisldgdvtffgalkll
Timeline for d1osgd_: