SCOP 1.65: Domain d1orwd1: 1orw D:39-508

Lineage for d1orwd1 (1orw D:39-508)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: Dipeptidyl peptidase IV/CD26, N-terminal domain [82171] (1 family)

5. Family b.70.3.1: Dipeptidyl peptidase IV/CD26, N-terminal domain [82172] (1 protein)

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89381] (2 PDB entries)

8. Domain d1orwd1: 1orw D:39-508 [87368]
   Other proteins in same PDB: d1orwa2, d1orwb2, d1orwc2, d1orwd2
   complexed with man, nag, p2y, phi, sul

Details for d1orwd1

PDB Entry: 1orw, 2.84 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a peptidomimetic inhibitor

SCOP Domain Sequences for d1orwd1:

Sequence; same for both SEQRES and ATOM records:

>d1orwd1 b.70.3.1 (D:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa)}
srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

Timeline for d1orwd1:

• d1orwd1 is new in SCOP 1.65
  
• d1orwd1 appears in SCOP 1.67
  
• d1orwd1 appears in the current release, SCOPe 2.08