Lineage for d1orwb2 (1orw B:509-766)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 319445Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 319446Superfamily c.69.1: alpha/beta-Hydrolases [53474] (26 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 319958Family c.69.1.24: Dipeptidyl peptidase IV/CD26, C-terminal domain [82497] (1 protein)
    N-terminal domain is a 8-bladed beta-propeller
  6. 319959Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 319965Species Pig (Sus scrofa) [TaxId:9823] [89771] (2 PDB entries)
  8. 319971Domain d1orwb2: 1orw B:509-766 [87365]
    Other proteins in same PDB: d1orwa1, d1orwb1, d1orwc1, d1orwd1

Details for d1orwb2

PDB Entry: 1orw (more details), 2.84 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a peptidomimetic inhibitor

SCOP Domain Sequences for d1orwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orwb2 c.69.1.24 (B:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa)}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

SCOP Domain Coordinates for d1orwb2:

Click to download the PDB-style file with coordinates for d1orwb2.
(The format of our PDB-style files is described here.)

Timeline for d1orwb2: