SCOPe 2.08: Domain d1orwa1: 1orw A:39-508

Lineage for d1orwa1 (1orw A:39-508)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89381] (8 PDB entries)

8. Domain d1orwa1: 1orw A:39-508 [87362]
   Other proteins in same PDB: d1orwa2, d1orwb2, d1orwc2, d1orwd2
   complexed with nag, p2y, phi, so4

Details for d1orwa1

PDB Entry: 1orw, 2.84 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a peptidomimetic inhibitor

PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1orwa1:

Sequence; same for both SEQRES and ATOM records:

>d1orwa1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

Timeline for d1orwa1:

• d1orwa1 first appeared in SCOP 1.65
  
• d1orwa1 appears in SCOPe 2.07