SCOP 1.65: Domain d1orvd2: 1orv D:509-766

Lineage for d1orvd2 (1orv D:509-766)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (26 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: Dipeptidyl peptidase IV/CD26, C-terminal domain [82497] (1 protein)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89771] (2 PDB entries)

8. Domain d1orvd2: 1orv D:509-766 [87361]
   Other proteins in same PDB: d1orva1, d1orvb1, d1orvc1, d1orvd1
   complexed with man, nag, sul

Details for d1orvd2

PDB Entry: 1orv, 1.8 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26)

SCOP Domain Sequences for d1orvd2:

Sequence; same for both SEQRES and ATOM records:

>d1orvd2 c.69.1.24 (D:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa)}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

Timeline for d1orvd2:

• d1orvd2 is new in SCOP 1.65
  
• d1orvd2 appears in SCOP 1.67
  
• d1orvd2 appears in the current release, SCOPe 2.08