Lineage for d1orvd1 (1orv D:39-508)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076457Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2076570Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2076571Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2076578Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2076807Species Pig (Sus scrofa) [TaxId:9823] [89381] (8 PDB entries)
  8. 2076811Domain d1orvd1: 1orv D:39-508 [87360]
    Other proteins in same PDB: d1orva2, d1orvb2, d1orvc2, d1orvd2
    complexed with nag, so4

Details for d1orvd1

PDB Entry: 1orv (more details), 1.8 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26)
PDB Compounds: (D:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1orvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orvd1 b.70.3.1 (D:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

SCOPe Domain Coordinates for d1orvd1:

Click to download the PDB-style file with coordinates for d1orvd1.
(The format of our PDB-style files is described here.)

Timeline for d1orvd1: