Lineage for d1orvd1 (1orv D:39-508)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379960Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 380036Superfamily b.70.3: Dipeptidyl peptidase IV/CD26, N-terminal domain [82171] (1 family) (S)
  5. 380037Family b.70.3.1: Dipeptidyl peptidase IV/CD26, N-terminal domain [82172] (1 protein)
  6. 380038Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 380050Species Pig (Sus scrofa) [TaxId:9823] [89381] (2 PDB entries)
  8. 380054Domain d1orvd1: 1orv D:39-508 [87360]
    Other proteins in same PDB: d1orva2, d1orvb2, d1orvc2, d1orvd2
    complexed with man, nag, sul

Details for d1orvd1

PDB Entry: 1orv (more details), 1.8 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26)

SCOP Domain Sequences for d1orvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orvd1 b.70.3.1 (D:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa)}
srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

SCOP Domain Coordinates for d1orvd1:

Click to download the PDB-style file with coordinates for d1orvd1.
(The format of our PDB-style files is described here.)

Timeline for d1orvd1: