SCOP 1.67: Domain d1orsc_: 1ors C:

Lineage for d1orsc_ (1ors C:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)

6. Protein Potassium channel KVAP [90107] (1 species)

7. Species Archaeon Aeropyrum pernix [TaxId:56636] [90108] (2 PDB entries)

8. Domain d1orsc_: 1ors C: [87353]
   Other proteins in same PDB: d1orsa1, d1orsa2, d1orsb1, d1orsb2
   perimeter subdomain only

Details for d1orsc_

PDB Entry: 1ors, 1.9 Å

PDB Description: x-ray structure of the kvap potassium channel voltage sensor in complex with an fab

SCOP Domain Sequences for d1orsc_:

Sequence; same for both SEQRES and ATOM records:

>d1orsc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix}
dvmehplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayk
sgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskfls
aiadaadklvpr

Timeline for d1orsc_:

• d1orsc_ first appeared in SCOP 1.65
  
• d1orsc_ appears in SCOP 1.69
  
• d1orsc_ appears in the current release, SCOPe 2.08, called d1orsc1