![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
![]() | Domain d1orsb2: 1ors B:119-221 [87352] Other proteins in same PDB: d1orsa1, d1orsa2, d1orsb1, d1orsc_ part of anti-VD potassium channel KVAP Fab 33H1 |
PDB Entry: 1ors (more details), 1.9 Å
SCOP Domain Sequences for d1orsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orsb2 b.1.1.2 (B:119-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
Timeline for d1orsb2: