SCOP 1.65: Domain d1orsa1: 1ors A:1-107

Lineage for d1orsa1 (1ors A:1-107)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (12 PDB entries)

8. Domain d1orsa1: 1ors A:1-107 [87349]
   Other proteins in same PDB: d1orsa2, d1orsb1, d1orsb2, d1orsc_
   part of anti-VD potassium channel KVAP Fab 33H1

Details for d1orsa1

PDB Entry: 1ors, 1.9 Å

PDB Description: x-ray structure of the kvap potassium channel voltage sensor in complex with an fab

SCOP Domain Sequences for d1orsa1:

Sequence; same for both SEQRES and ATOM records:

>d1orsa1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1}
qivltqspaimsaslgdrvtmtctasssvsssylhwyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissmeaedaatyychqfhrsltfgsgtkleik

Timeline for d1orsa1:

• d1orsa1 is new in SCOP 1.65
  
• d1orsa1 appears in SCOP 1.67
  
• d1orsa1 appears in the current release, SCOPe 2.08