Lineage for d1orqc_ (1orq C:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519626Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 519627Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 519628Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)
  6. 519633Protein Potassium channel KVAP [90107] (1 species)
  7. 519634Species Archaeon Aeropyrum pernix [TaxId:56636] [90108] (2 PDB entries)
  8. 519636Domain d1orqc_: 1orq C: [87348]
    Other proteins in same PDB: d1orqa1, d1orqa2, d1orqb1, d1orqb2
    gate and perimeter subdomains

Details for d1orqc_

PDB Entry: 1orq (more details), 3.2 Å

PDB Description: X-ray structure of a voltage-dependent potassium channel in complex with an Fab

SCOP Domain Sequences for d1orqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orqc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix}
igdvmehplvelgvsyaallsvivvvvectmqlsgeylvrlylvdlilviilwadyayra
yksgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskf
lsaiadaadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfdalwwavvtattv
gygdvvpatpigkvigiavmltgisaltlligtvsnmfqkilv

SCOP Domain Coordinates for d1orqc_:

Click to download the PDB-style file with coordinates for d1orqc_.
(The format of our PDB-style files is described here.)

Timeline for d1orqc_: