SCOP 1.67: Domain d1orqc_: 1orq C:

Lineage for d1orqc_ (1orq C:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)

6. Protein Potassium channel KVAP [90107] (1 species)

7. Species Archaeon Aeropyrum pernix [TaxId:56636] [90108] (2 PDB entries)

8. Domain d1orqc_: 1orq C: [87348]
   Other proteins in same PDB: d1orqa1, d1orqa2, d1orqb1, d1orqb2
   gate and perimeter subdomains
   complexed with cd, k; mutant

Details for d1orqc_

PDB Entry: 1orq, 3.2 Å

PDB Description: x-ray structure of a voltage-dependent potassium channel in complex with an fab

SCOP Domain Sequences for d1orqc_:

Sequence; same for both SEQRES and ATOM records:

>d1orqc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix}
igdvmehplvelgvsyaallsvivvvvectmqlsgeylvrlylvdlilviilwadyayra
yksgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskf
lsaiadaadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfdalwwavvtattv
gygdvvpatpigkvigiavmltgisaltlligtvsnmfqkilv

Timeline for d1orqc_:

• d1orqc_ first appeared in SCOP 1.65
  
• d1orqc_ appears in SCOP 1.69
  
• d1orqc_ appears in the current release, SCOPe 2.08