Lineage for d1orqb2 (1orq B:119-219)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453736Domain d1orqb2: 1orq B:119-219 [87347]
    Other proteins in same PDB: d1orqa1, d1orqa2, d1orqb1, d1orqc_
    part of anti-VD potassium channel KVAP Fab 6E1

Details for d1orqb2

PDB Entry: 1orq (more details), 3.2 Å

PDB Description: x-ray structure of a voltage-dependent potassium channel in complex with an fab

SCOP Domain Sequences for d1orqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orqb2 b.1.1.2 (B:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsd
lytlsssvtvtsntwpsqsitcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1orqb2:

Click to download the PDB-style file with coordinates for d1orqb2.
(The format of our PDB-style files is described here.)

Timeline for d1orqb2: