Lineage for d1orna1 (1orn A:3-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2720981Family a.96.1.1: Endonuclease III [48151] (1 protein)
  6. 2720982Protein Endonuclease III [48152] (1 species)
  7. 2720983Species Escherichia coli [TaxId:562] [48153] (4 PDB entries)
  8. 2720984Domain d1orna1: 1orn A:3-214 [87342]
    Other proteins in same PDB: d1orna2
    protein/DNA complex; complexed with na, sf4, trs

Details for d1orna1

PDB Entry: 1orn (more details), 1.7 Å

PDB Description: Structure of a Trapped Endonuclease III-DNA Covalent Intermediate: Estranged-Guanine Complex
PDB Compounds: (A:) endonuclease III

SCOPe Domain Sequences for d1orna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orna1 a.96.1.1 (A:3-214) Endonuclease III {Escherichia coli [TaxId: 562]}
tkqqirycldemakmfpdahcelvhrnpfelliavvlsaqctdalvnkvtkrlfekyrtp
hdyiavpleeleqdirsiglyrnkarniqklcamlidkyngevprdrdelmklpgvgrkt
anvvvsvafgvpaiavdthvervskrlgfcrwddsvlevektlmkiipkeewsithhrmi
ffgryhckaqspqcpscpllhlcregkkrmrk

SCOPe Domain Coordinates for d1orna1:

Click to download the PDB-style file with coordinates for d1orna1.
(The format of our PDB-style files is described here.)

Timeline for d1orna1: