Lineage for d1orfa_ (1orf A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465490Protein Granzyme A [89345] (1 species)
  7. 465491Species Human (Homo sapiens) [TaxId:9606] [89346] (2 PDB entries)
  8. 465492Domain d1orfa_: 1orf A: [87338]

Details for d1orfa_

PDB Entry: 1orf (more details), 2.4 Å

PDB Description: the oligomeric structure of human granzyme a reveals the molecular determinants of substrate specificity

SCOP Domain Sequences for d1orfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens)}
iiggnevtphsrpymvllsldrkticagaliakdwvltaahcnlnkrsqvilgahsitre
eptkqimlvkkefpypcydpatregdlkllqltekakinkyvtilhlpkkgddvkpgtmc
qvagwgrthnsaswsdtlreveitiidrkvcndrnhynfnpvigmnmvcagslrggrdsc
ngdsgspllcegvfrgvtsfglenkcgdprgpgvyillskkhlnwiimtikg

SCOP Domain Coordinates for d1orfa_:

Click to download the PDB-style file with coordinates for d1orfa_.
(The format of our PDB-style files is described here.)

Timeline for d1orfa_: